SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010416 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010416
Domain Number 1 Region: 349-445
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-24
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 248-341
Classification Level Classification E-value
Superfamily Immunoglobulin 3.84e-22
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010416   Gene: ENSNLEG00000008526   Transcript: ENSNLET00000010926
Sequence length 498
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:5267449:5289020:1 gene:ENSNLEG00000008526 transcript:ENSNLET00000010926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTQQRFSASSTLSS
HITMSSSAFPASPQQPAGSNSGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNY
QQFSAGQPVNAKPSQTANAKPTPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLT
YEEKMARRLLGPQNAAAVFQAQDDSGAQDSQLHNSEHARLQVPTSQVRSRSSSRGNVNDQ
DAIQEKFYPPRFIQVPENMSIDEGRFCRMDFKVSGLPAPDVSWYLNGRPVQSDDLHKMIV
SEKGFHSLIFEVVRASDAGAYACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQSKKV
LEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGW
YTVSAVNEAGVTTCNTRLDVTARPNQTLPAPKQLRVRPTFSKYLALNGKGLNVKQAFNPE
GEFQRLAAQSGLYESEEL
Download sequence
Identical sequences G1RB19
XP_003266471.1.23891 ENSNLEP00000010416 ENSNLEP00000010416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]