SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010419 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010419
Domain Number 1 Region: 678-973
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-78
Family Protein kinases, catalytic subunit 0.0000000000302
Further Details:      
 
Domain Number 2 Region: 299-491
Classification Level Classification E-value
Superfamily L domain-like 1.62e-46
Family L domain 0.000000145
Further Details:      
 
Domain Number 3 Region: 20-180
Classification Level Classification E-value
Superfamily L domain-like 4.82e-43
Family L domain 0.000000298
Further Details:      
 
Domain Number 4 Region: 476-607
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.71e-24
Family Growth factor receptor domain 0.0000000617
Further Details:      
 
Domain Number 5 Region: 157-310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.81e-19
Family Growth factor receptor domain 0.0000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010419   Gene: ENSNLEG00000008441   Transcript: ENSNLET00000010929
Sequence length 1180
Comment pep:known_by_projection supercontig:Nleu1.0:GL397372.1:4834990:4902863:1 gene:ENSNLEG00000008441 transcript:ENSNLET00000010929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYV
LIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNLQEILHGAVR
FSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQK
LTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLML
YNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKC
EGPCRKVCNGIGIGEFKDTLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDP
QELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLG
LRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHAL
CSPEGCWGPEPRDCVSCRNVSRGRECVDKCNILEGEPREFVENSECIQCHPECLPQVMNI
TCTGQGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADASHVCHLCHPNCTYGCA
GPGLEGCANGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVE
PLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREA
TSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIG
SQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYH
AEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKG
ERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLP
SPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACI
DRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVY
HNQPLNPTPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNP
DYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA
Download sequence
Identical sequences ENSNLEP00000010419 ENSNLEP00000010419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]