SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010433 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010433
Domain Number 1 Region: 16-65
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.19e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 237-282
Classification Level Classification E-value
Superfamily UBA-like 0.000000104
Family CUE domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010433   Gene: ENSNLEG00000008556   Transcript: ENSNLET00000010943
Sequence length 466
Comment pep:known_by_projection supercontig:Nleu1.0:GL397359.1:1707293:1722440:1 gene:ENSNLEG00000008556 transcript:ENSNLET00000010943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQR
VMAAQVALRRQQANESLESLIPDSLRALPGPPPPGDAAAAQQPPPASQPSQPQPPRPAAE
LAGAAALRWSAEPQPGALQAQVAKPDLTEERLGDGNSADNTEVFSDKDTDQRSSPDVAKS
KGCFTPESPEIVSVDEEGYAVQKNGGNPESRPDSPKYHAEQNHLLIEGPSGTVSLPFSLK
ANRPPLEVLKKIFPNQKPTVLELILKGCGGDLVSAVEVLLSSRSSVTGAERASAEPEGLV
LPPNGHIFEPTLSSCPISSSKWCVGSAFRVPDTLRFSADSSNVVPNPLAVPLQHPFPQPP
RYPLMLRNTLARNQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFSSNSTSVFRSSPVLP
ARATEDPRISIPDDGCPIASKQSIYTEDDYDERSDSSDSRILNTSS
Download sequence
Identical sequences ENSNLEP00000010433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]