SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010435 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010435
Domain Number 1 Region: 36-134
Classification Level Classification E-value
Superfamily Fibronectin type III 6.72e-16
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 120-214
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000326
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010435   Gene: ENSNLEG00000008543   Transcript: ENSNLET00000010946
Sequence length 375
Comment pep:known_by_projection supercontig:Nleu1.0:GL397281.1:1498480:1516982:-1 gene:ENSNLEG00000008543 transcript:ENSNLET00000010946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHLLWICKVTSSLLDLPLCTLQLLLKESTGEGVQIQIIYFNLETVQVTWNASKYSRTNL
TFHYRFKGDEAYDQCTNYVLLEGYTSGCLLDAEQRDDILYFSIRNGTQPVFTASRWVVYY
LKPSFPKHVSFSWHQDVVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLD
AEKCYSFRVRVKAMEDAYGPDTYPSDWSEVTCWQRGEIRDSCAETPTPPKPKLSKFILIS
SLAILLMVSLLLLSLWKLWRVKKFLMPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHL
NKMAGVEQEGGPEEPLVVQLAKTEAESPRTLDPQTEEKEASGASLQLPHQPLQGGDVVTI
GGFTFVMNDSAYVVL
Download sequence
Identical sequences ENSNLEP00000010435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]