SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010460 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010460
Domain Number 1 Region: 725-833
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-22
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 2 Region: 195-315
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.1e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 11-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000614
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 541-701
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000965
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 5 Region: 157-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000131
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 61-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000384
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 102-140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000802
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010460   Gene: ENSNLEG00000008527   Transcript: ENSNLET00000010972
Sequence length 910
Comment pep:known_by_projection supercontig:Nleu1.0:GL397446.1:1186358:1205410:1 gene:ENSNLEG00000008527 transcript:ENSNLET00000010972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPHGPTDYLSCTDVDECAEGNGGCQQSCVNMMGSYECHCREGFFLSDNQHTCIQRPEEGM
NCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGP
RCGCHIKFVLHTDGKTCIGERRLEQHIPTQAVSNETCAVNNGGCDSKCHDAATGVHCTCP
VGFMLQPDRKTCKDIDECRLNNGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECS
FDRTCDHICVNTPGSFQCLCHRGYLLYGVTHCGDVDECSINRGGCRFGCINTPGSYQCTC
PAGQGRLHWNGKDCTEPLKCQGSPGASKAMLSCNRSGKKDTCALTCPSRARFLPESENGF
TVSCGTPSPRAAPARAGHNGNSTNSNHCHEAAVLSIKQRASFKIKDAKCRLHLRNKGKTE
EAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRAEET
TASCGLPCLRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAQKPGLVAGERAEPME
SCRPGQHRAGTKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGA
TNVTTCAGQCPPGQHSADGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGAISFQDC
DTKVQCSPGHYYNTSIHRCIRCAMGSYQPDFRQNFCTRCPGNTSTDFDGSTSVAQCKNRQ
CGGELGEFTGYIESPNYPGNYPASVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVM
RKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQL
VEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKLLRS
KVSSFLRPYK
Download sequence
Identical sequences ENSNLEP00000010460 ENSNLEP00000010460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]