SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010475 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000010475
Domain Number - Region: 82-174
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000864
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010475   Gene: ENSNLEG00000008591   Transcript: ENSNLET00000010987
Sequence length 352
Comment pep:known_by_projection supercontig:Nleu1.0:GL397443.1:1264544:1265665:1 gene:ENSNLEG00000008591 transcript:ENSNLET00000010987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRSILSKLQSVCTEDSYPAEGAGPPRPASGRSQPGRSPPPPPPPEPSDAPCADDECFSGD
GTTPLVALPTLATQAEARPLIKVKQLTQNSATITVQLPSPFHRMYTLEHFNNSKASTVSR
LTKAQEEIRLTNLFTLTNYTYCVVSTSAGLRHNHTCLTICLPRLPSPPGPVPSPSTATHY
IMTILGCLFGMVLVLGAVYYCLRRRRRQEEKHKKAASAAAAGSLKKTIIELKYGPELEAP
GLAPLSQGPLLGPEAVTRIPYLPATGEVEQYKLVESADTPKASKGSYIESSVAEISTIAK
EVDKVNQIINNCIDALKSESASFQGVKSGPVSAAEPPLVLLSEPLAAKHGFL
Download sequence
Identical sequences ENSNLEP00000010475 ENSNLEP00000010475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]