SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010483 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000010483
Domain Number - Region: 22-48
Classification Level Classification E-value
Superfamily Elafin-like 0.0641
Family Elafin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010483   Gene: ENSNLEG00000008587   Transcript: ENSNLET00000010996
Sequence length 165
Comment pep:known_by_projection supercontig:Nleu1.0:GL397389.1:4793590:4794630:1 gene:ENSNLEG00000008587 transcript:ENSNLET00000010996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLR
TGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNI
ADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFAELAHKAG
Download sequence
Identical sequences ENSNLEP00000010483 ENSNLEP00000010483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]