SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010489 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010489
Domain Number 1 Region: 654-807
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-36
Family MAM domain 0.0008
Further Details:      
 
Domain Number 2 Region: 63-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-32
Family MAM domain 0.0064
Further Details:      
 
Domain Number 3 Region: 969-1133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-31
Family MAM domain 0.0029
Further Details:      
 
Domain Number 4 Region: 810-967
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-27
Family MAM domain 0.001
Further Details:      
 
Domain Number 5 Region: 270-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-18
Family MAM domain 0.011
Further Details:      
 
Domain Number 6 Region: 489-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-16
Family MAM domain 0.016
Further Details:      
 
Domain Number 7 Region: 225-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.003
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010489
Domain Number - Region: 456-495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00072
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 28-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0375
Family LDL receptor-like module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010489   Gene: ENSNLEG00000008540   Transcript: ENSNLET00000011002
Sequence length 1216
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:532262:541901:1 gene:ENSNLEG00000008540 transcript:ENSNLET00000011002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPSHLLPALVLFLAGSSGWAWVPNHCRSPGQAVCNFLCDCRDCSDEAQCGYHGAWPTL
GTPFTCDFEQDPCGWRDISTSGYSWLRDRAGAALEGPGPHSDHTLGTDLGWYMAVGTHRG
KEASTAALRSPTLREAASSCKLRLWYHAASGDVAELRLELTHGAETLTLWQSTGPWGPGW
QELAVTTGRIRGDFRVTFSATRNATHRGAVALDDLEFWDCGLPTPQASCPLGHHHCENKV
CVEPQQLCDAEDNCGDQSDENPLTCGHHIATDFETGLGPWNRSEGWSQNHSAGGPERPSW
PRRDHSRNSAQGSFLVSVAEPGTPAILSSPKFQASGTSNCSLVFYHYLHGSEAGCLQLFL
QTLGPSAPQAPVLLRRRRGELGTAWVRDRVDIQSAHPFQILLTGQTGPGGVVGLDDLILS
DHCRPVSEVSTLQPLPPGPWAPAPQPLPPSSRLQDSCERGHLACGDLCVPPEQLCDFEEQ
CAAGEDEQACGTTDFESPEAGGWEDASVGRLQWRRLSAQEGQGSSAAAAGHFLSLQRAWG
QLSAEARVLTPLLGPSGPNCELHLAYYLQSQPRGFLALVVVDNGNRELAWQALSSSAGSW
KVDKVLLGARRRRFRLEFVSLVDLDGPDQQGAGVDNVTLRDCSPTVTTERDREISCNFER
DTCSWYPGHLSDTHWRWVESHGPDHDHTTDQGHFVLLDPTDPLAWGHSAHLFSRPQVPAA
PTECLSFWYHLHGPQIGTLRLAMRREGEEIHLWSRSGTQGNRWHEAWATLSHQPGSRAQY
QLLFEGLRDGYHGTMALDDVAVRPGPCWAPNDCSFEDSDCGFSPGGQGLWRRQANASGHA
AWGPPTDHTTETARGHYMLVDTSPDALPRGQTASLTSKEHRPLAQPACLTFWYHGSLHSP
GTLRVYLEESGRHQVLSLSAHGGLAWRLGSVDVQAKQAWRVVFEAVAADVAHSYVALDDL
LLQDGPCPQPGSCDFESGLCGWSHLAWPGLGRYSWDWGGGATPSRYPQPRVDHTLGTEAG
HFAFFETGVLGPGGRAAWLRSELLPATPASCLRFWYHMDFPEHFYKGELKVLLHSAQGQL
AVWGTGGHRRHQWLEAQVEVASTKEFQIVFEATLGGQPALGPIALDDVEYLAGQHCQQPA
PSPGDTAAPVSVPAAVGSTLLLLMLLVLLGLGGRRWLQKRGSCPFQSNTEATAPSFDNIL
FNAESPTLPHEHTSAP
Download sequence
Identical sequences ENSNLEP00000010489 ENSNLEP00000010489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]