SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010515 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010515
Domain Number 1 Region: 52-297
Classification Level Classification E-value
Superfamily L domain-like 5.21e-36
Family Ngr ectodomain-like 0.03
Further Details:      
 
Domain Number 2 Region: 774-873
Classification Level Classification E-value
Superfamily DEATH domain 2.49e-20
Family DEATH domain, DD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010515   Gene: ENSNLEG00000008607   Transcript: ENSNLET00000011029
Sequence length 902
Comment pep:known_by_projection supercontig:Nleu1.0:GL397536.1:550861:561336:-1 gene:ENSNLEG00000008607 transcript:ENSNLET00000011029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATVEEPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQ
LLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAG
LSGLAHLAHLDLSFNSLETLPACVLRMRGLGALLLSHNCLSELPEALGALPALTFLAVTH
NRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLR
SLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASP
DAPSSPVAALIPEMPRLFLTSDLDSFPVTPRGCSVTLACGVRLQFPAGATATPITVRYRL
LLPEPGLVPLGPHDALLSHVLELQPHGGVAGGSDVGLWLLFTPPRARRCREVVVRTRNDN
SWGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVI
FPPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLRLVTVQLPLP
SGITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNC
VGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLQRYRGPEPSDT
VEMFEGEEFFAAFERGINVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRG
QVGRGVGEGRGPPGRLGRGPSSEPHSMPLQRLRGSEVTWWGAGLSLAPLNLGDAETGFLT
QSNLLSVAGRLGPDWPAVALHLGMSYRELQRIRHEFRDDLDGQIRHMLFSWAERQAGQPG
AVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDGIRRTGLAPKDPALPGSSAPQPPEPA
QA
Download sequence
Identical sequences ENSNLEP00000010515 ENSNLEP00000010515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]