SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010523 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010523
Domain Number 1 Region: 395-544
Classification Level Classification E-value
Superfamily TRAF domain-like 9.32e-53
Family MATH domain 0.0000000455
Further Details:      
 
Domain Number 2 Region: 356-394
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.000000000000314
Family Trimerization domain of TRAF 0.00028
Further Details:      
 
Domain Number 3 Region: 27-74
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000778
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010523
Domain Number - Region: 257-283
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0137
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010523   Gene: ENSNLEG00000008615   Transcript: ENSNLET00000011038
Sequence length 546
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:560298:605613:1 gene:ENSNLEG00000008615 transcript:ENSNLET00000011038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YEVKMPACGMVTEPRSPSSYDLVLHVPLTGAEACLVSVEEETELLVRSCHEGRCPLMLTE
CPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKK
KIPREKFQDHIKTCGKCRVPCRFHAIGCLETVEGEKQQEHEAQWLREHLAMLLSSVLEAK
PLSGDQSHVGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIE
ALSNKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRTPA
IFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLL
DQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAI
VDLTGL
Download sequence
Identical sequences ENSNLEP00000010523 ENSNLEP00000010523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]