SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010527 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010527
Domain Number 1 Region: 350-499
Classification Level Classification E-value
Superfamily TRAF domain-like 7.85e-53
Family MATH domain 0.0000000455
Further Details:      
 
Domain Number 2 Region: 311-349
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.000000000000262
Family Trimerization domain of TRAF 0.00028
Further Details:      
 
Domain Number 3 Region: 27-74
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000707
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010527
Domain Number - Region: 212-238
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0124
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 
Domain Number - Region: 105-166
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0163
Family SIAH, seven in absentia homolog 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010527   Gene: ENSNLEG00000008615   Transcript: ENSNLET00000011042
Sequence length 501
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:560298:605613:1 gene:ENSNLEG00000008615 transcript:ENSNLET00000011042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHIKTCGKCRVPCRFHAIGCLETVEGEKQQEHEAQWL
REHLAMLLSSVLEAKPLSGDQSHVGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
Download sequence
Identical sequences G1RBD0
XP_003279839.1.23891 XP_003279840.1.23891 ENSNLEP00000010527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]