SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010528 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010528
Domain Number 1 Region: 258-287
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000106
Family CCCH zinc finger 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010528
Domain Number - Region: 613-650
Classification Level Classification E-value
Superfamily RING/U-box 0.00129
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number - Region: 56-78
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010528   Gene: ENSNLEG00000008624   Transcript: ENSNLET00000011043
Sequence length 655
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:1324143:1372764:-1 gene:ENSNLEG00000008624 transcript:ENSNLET00000011043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRDGTFNYSPDVYCSKYN
EATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPL
DLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVL
GSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYRSTPCPSVKHGDEWGEPSRCD
GGDGCQYCHSRTEQQFHPESTKCNDMRQTGYCPRGPFCAFAHVEKSLGMANEWGCRDLHL
TSPASTGSGQPGNAKRRDSPAEGGPKGSEQDSKQNHLAVFAAVHPPAPSMSSSVASSLAS
STGSGSSSPTALPAPPARALPLGPASSTVEAVLGSALDLHLSNVNIASLEKDLEEQDGHD
LGPAGPRSLAGSAPVAIPGSLPRAPSLHSPSSASTSPLSSLSQPLPGPVGSSAMTPPQQP
PPLRSESGALGSAASSYSPLGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSASPNGA
ELARVRRQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEE
VEAQVIFQLRAKQCVACRERAHGAVLQPCQHHVLCEPCAATAPECPYCKGQPLQW
Download sequence
Identical sequences ENSNLEP00000010528 ENSNLEP00000010528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]