SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010554 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010554
Domain Number 1 Region: 522-555,637-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010554   Gene: ENSNLEG00000008644   Transcript: ENSNLET00000011069
Sequence length 759
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:1929364:1958752:1 gene:ENSNLEG00000008644 transcript:ENSNLET00000011069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSTNAFEENHKKRDRHHKGFLDHAKACCSCSTQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYFFFG
TSRHISVGPFPILSMMVGLAVSGAVTARNETTSGSSNSWSDNSLSPDDERVNAAVAVTVL
SGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHTDPLSIFK
VLVSVFSQIEKTNIADMVTALIILLVVSIVKEINQRFKDKLPVPIPIEFIMTVIAAGVSY
GFDFKNRFNVTVVGDMNPGFQPPLTPNVTIFKETIGDCFGIALVAFAVAFSVASVYSLKY
DYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAIIVLIVI
LAIGFLLAPLQKSVLAALALGNLKGMLMQFAEICRLWRKDKYDCLIWIVTFVFTIVLGLG
LGLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIYKNKKDYYDMYEPEGVKIFRCPSPIY
FANIGFFRQKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSD
EELDNNQIEVLDQPINTTDLPFQIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSMR
GLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKNSIFFLTIHDAVLHILMKKD
YSTSKFNPSQEKYGKIDFTINTNGGLRNRVYQVPIETKF
Download sequence
Identical sequences G1RBF7
XP_003268183.1.23891 XP_012367503.1.23891 ENSNLEP00000010554 ENSNLEP00000010554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]