SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010555 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010555
Domain Number 1 Region: 182-384
Classification Level Classification E-value
Superfamily Fibronectin type III 3.86e-24
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 2 Region: 442-657
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000223
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 3 Region: 129-176
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000366
Family Elafin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010555   Gene: ENSNLEG00000008627   Transcript: ENSNLET00000011070
Sequence length 680
Comment pep:known_by_projection supercontig:Nleu1.0:GL397281.1:5745861:5955091:-1 gene:ENSNLEG00000008627 transcript:ENSNLET00000011070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGVPGAVLTLCLWLAASRGCLAAGPGAAAARRLDESLSAGSVQRARCASRCLSLQITR
ISAFFQHFQNNGSLVWCQNHKQCSKCLEPCKESADLRKHQCQSFCEPLFPKKSYECLTSC
EFLKYILLVKQGDCPAPEKASGFAAACVESCEVDNECSGVKKCCSNGCGHTCQVPKTLYK
GVPLKPRKELRFTELQSGQLEVKWSSKFNISIEPVIYVVQRRWNYGIHPSEDDATHWQTV
AQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDPSAPPAPANLRLAN
STINSDGSVTVTIVWDLPEEPDIPVHHYKVFWSWTVSSKSLVPTKKKRRKTTDGFQNSVI
LEKLQPDCDYVVELQAITYWGQTRLKSAKVSLHFTSTRAASNKEQLVKTRKGGIQTQLPF
QRRRPTRPLEVGAPFYQDGQLQVKVYWKKTEDPTVNRYHVRWFPEACAHNRTIGSEASSG
MTHENYIILQDLSFSCKYKVTVQPIRPKSHSKAEAVFFTTPPCSALKGKSHKPVGCSGEA
GHVLSKVLAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNS
LPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPPSSA
HRSHLKHRHPHHYKPSPERY
Download sequence
Identical sequences G1RBF8
XP_003261044.1.23891 ENSNLEP00000010555 ENSNLEP00000010555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]