SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010591 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010591
Domain Number 1 Region: 443-700
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-49
Family YWTD domain 0.0000001
Further Details:      
 
Domain Number 2 Region: 234-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000209
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000262
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 4 Region: 149-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000127
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 5 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000929
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 357-434,701-751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000138
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 10 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010591   Gene: ENSNLEG00000008596   Transcript: ENSNLET00000011107
Sequence length 873
Comment pep:known_by_projection supercontig:Nleu1.0:GL397359.1:3406884:3438843:1 gene:ENSNLEG00000008596 transcript:ENSNLET00000011107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWALWLLLALCWAPRESCATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRINEISC
GAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPNEFTCSSGRCISRNFVCNGQDDCS
DGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCRDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDINKVCNQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTVDIQ
WPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLESLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCL
PAPQFNDHSPKYTCSCPNGYNLEENGRDCQSTATTVTYSETKDTNTTEMSPTSGLVPRGI
NVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences G1RBJ4
XP_003273909.1.23891 ENSNLEP00000010591 ENSNLEP00000010591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]