SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010594 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010594
Domain Number 1 Region: 261-506
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.65e-82
Family Eukaryotic proteases 0.0002
Further Details:      
 
Domain Number 2 Region: 165-266
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.078
Further Details:      
 
Domain Number 3 Region: 131-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010594
Domain Number - Region: 23-89
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000811
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010594   Gene: ENSNLEG00000008677   Transcript: ENSNLET00000011110
Sequence length 506
Comment pep:known_by_projection supercontig:Nleu1.0:GL397493.1:1077124:1106257:-1 gene:ENSNLEG00000008677 transcript:ENSNLET00000011110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHIEHSRYLSLLDAVDKSKMALNSGSPPGFGPYYENHGYQPENPYPAQPTVAPSVYEVHP
AQYYPSPVPQYAPRVLTQASNPVVRTQPQSPSGTVCTSKTKKALCITLTLGAFLVGAALA
AGLLWKFMGSKCSDSGIECDSSGICISASNWCDGVSHCPSGEDENRCVRLYGPNFILQVY
SSQRKSWHPVCQDDWNENYGRAACRDMGYKNSFYSSQGIVDDSGATSFMKLNTSARNVDI
YKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGGSARLGAWPWQVSLHVQNVHVC
GGSIITPEWIVTAAHCVEKPLNNPWHWTAFGILRQPFLSYSGHQVEKVISHPNYDSKTKN
NDIALMKLQTPLTFNDFVKPVCLPNPGLMLEPEQRCWISGWGATEEKGKTSDELNAAMVR
LIEMQRCNSRYVYDNLITPAMICAGFLQGTVDSCQGDSGGPLVTSKDNVWWLIGDTSWGS
GCAKAYRPGVYGNVTVFTDWIYRQMR
Download sequence
Identical sequences ENSNLEP00000010594 ENSNLEP00000010594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]