SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010596 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010596
Domain Number 1 Region: 443-700
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-49
Family YWTD domain 0.0000001
Further Details:      
 
Domain Number 2 Region: 234-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000249
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 4 Region: 149-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000123
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 5 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 9 Region: 360-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000849
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 357-434,701-751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 11 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000694
Family LDL receptor-like module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010596   Gene: ENSNLEG00000008596   Transcript: ENSNLET00000011112
Sequence length 845
Comment pep:known_by_projection supercontig:Nleu1.0:GL397359.1:3406884:3438843:1 gene:ENSNLEG00000008596 transcript:ENSNLET00000011112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWALWLLLALCWAPRESCATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRINEISC
GAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPNEFTCSSGRCISRNFVCNGQDDCS
DGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCRDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDINKVCNQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTVDIQ
WPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLESLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCL
PAPQFNDHSPKYTCSCPNGYNLEENGRDCQRINVTTAVSEVSVPPKGTSAAWAILPLLLL
VMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVST
DDDLA
Download sequence
Identical sequences G1RBJ9
ENSNLEP00000010596 XP_003273910.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]