SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010656 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010656
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000344
Family C2 set domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010656   Gene: ENSNLEG00000008735   Transcript: ENSNLET00000011174
Sequence length 176
Comment pep:novel contig::ADFV01136384.1:24575:35490:-1 gene:ENSNLEG00000008735 transcript:ENSNLET00000011174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEPSKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLAGNVTTSQMANEQGLFDVHS
VLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGQPMTFPPEALWVTVGLSVCLV
ALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Download sequence
Identical sequences ENSNLEP00000010656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]