SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010773 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010773
Domain Number 1 Region: 30-85
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.08e-16
Family Ovomucoid domain III-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010773   Gene: ENSNLEG00000008829   Transcript: ENSNLET00000011294
Sequence length 85
Comment pep:known_by_projection supercontig:Nleu1.0:GL397316.1:5219295:5231714:-1 gene:ENSNLEG00000008829 transcript:ENSNLET00000011294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMALAVLRLRCCSXXFLLTASLIPQFGLFSKYRTPNCAQYRLPGCPRNFNPVCGSDMSTY
ANECTLCMKIREDGHNIKIIRNGPC
Download sequence
Identical sequences ENSNLEP00000010773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]