SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010793 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010793
Domain Number 1 Region: 335-394
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000719
Family BSTI 0.061
Further Details:      
 
Domain Number 2 Region: 394-458
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000398
Family Fibronectin type I module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010793   Gene: ENSNLEG00000008833   Transcript: ENSNLET00000011320
Sequence length 623
Comment pep:known_by_projection supercontig:Nleu1.0:GL397536.1:963103:980719:1 gene:ENSNLEG00000008833 transcript:ENSNLET00000011320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVGRRKLAPLWTLALALAGTRHTGHAQDGSSKSSYKHHSALSPIAQGPGAVPLRGVTVF
PSLRTIPVVRASNPAHSGRVCSTWGNFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNI
QLRRSQESAAPTLSRILMKVDGVVIQLSKGSVLVNGCPFLLPFSQSGVLIQQSSSYTKVE
ARLGLVLMWNHDDSLLLELDAKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQK
MDDPMEQCQDPVPEPPRNCSTGFGICEELLHRQLFSGCVALVDVGSYLEACRQDLCFCED
TDPLSCVCHTLAEYSRQCAHAGGLPQDWRGPDLCPQKCPNNMQYHECRSPCADTCSNQEH
SRACEDHCVAGCFCPEGMVLDDIGQTGCVPASKCACVYNGAAYAPGATYSTDCANCTCSG
GRWSCQEVPCPGTCSVLGGAHFSTFDERQYTVHGDCSYVLTKPCDSSAFTVLAELHRCGL
TDSETCLKSVILSLDGAQTVVVIKASGEVFLNQIYTQLPISAEPVTIFRPSTFFIIAQTS
LGLQLNLQLVPTMQLFVRLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTF
KTQAACPNIRNSFEDPCSLSVEN
Download sequence
Identical sequences ENSNLEP00000010793 ENSNLEP00000010793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]