SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010799 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010799
Domain Number 1 Region: 753-954
Classification Level Classification E-value
Superfamily Fibronectin type III 1.87e-39
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 2 Region: 554-744
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-35
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 424-519
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-23
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 202-302
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 1395-1483
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 327-419
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000503
Family I set domains 0.029
Further Details:      
 
Domain Number 7 Region: 1179-1258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000732
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 1061-1147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000389
Family I set domains 0.032
Further Details:      
 
Domain Number 9 Region: 1300-1349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000317
Family I set domains 0.039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010799
Domain Number - Region: 968-1043
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00192
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010799   Gene: ENSNLEG00000008781   Transcript: ENSNLET00000011326
Sequence length 1491
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:4975481:5031116:-1 gene:ENSNLEG00000008781 transcript:ENSNLET00000011326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLYLRQCRLRDRILLPVPAELRARREQGPSRPPESSPQRLLSGHTASVVALVAMTLPHS
LGGAGDPRPPQAMEVHRLEHRQEEEQKEERQHSLRMGSSVRRRTFRSSEEEHEFSAADYS
LAAALALTASSELSWEAQLRRQTSAVELEERGQKRVGFGNDWERTEIAFLQTHRLLRQRR
DWKMLRRRTEEKVQEAKELRELCSGRGPWFWIPLRSHAVWEHTTVLLTCTVQASPPPQVT
WYKNDTRIDPRLFPAGKYRITNNYGLQSLEIRRCTIEDSATYTVRVKNAYGQASSFAKVL
VRTYLGKDAGFDSEIFKRSMFGPSVEFTSVLKPVFAREKEPFSLSCLLSEDVLDAESIQW
FRDGRLLRSSRRRKILYADRQASLKVSCTYKEDEGLYMVRVPSPFGPREQSTYVLVRDAE
AENPGAPGSPLNVRCLDVNRDCLILTWAPPSDTRGNPITAYSIERCQGDSGEWIPCHEAP
GGTCRCPIQGLVEGQSYRFRVRAISRAGSSVPSKASELVVMGDHDAARRKTEIPFDLGNK
ITISTDDFEDTVTIPSPPTNVHASEIREAYVVLAWEEPSPRGRAPLTYSLEKSVIGSGTW
EAISSESPVKSPRFAILDLEKNKSYVFRVRAMNQYGLSDPSEPSEPIALRGQPATLPPPA
QVQAFRDTQTSVSLTWDPVKDPELLGYYIYSREVGSSEWQTVNNKPIQGTRFTVPGLRTG
KEYEFCVRSVSEAGVGESSAATEPIRVKQALATPSAPYGFALLNCGKNEMVIGWKPPKRR
GGGKIMGYFLDQHDSEELDWHAVNQQPIPTRVCKVSDLHEGHFYEFRARAANWAGVGELS
APSSLFECKEWTMPQPGPPFDVRASEVRATSLVLQWEPPLYTGAGPVTGYHVSFQEEGSE
QWKPVTPGPISGTHLRVSDLQPGKSYVFQVQAVNSAGLGQPSMPTDPVLLEDKPGAHEIE
VGVDEEGFIYLAFEAPEAPDSSEFQWSKDYKGPLDPQRVKIEDKVNKSKVILKEPGLEDL
GTYSVIVTDADEDISASHTLTEEELEKLKKLSHEIRNPVIKLISGWNVDILERGEVRLWL
EVEKLSPAAELHLIFNNKEIFSSPNRKINFDREKGLVEVTIQNLSEEDKGSYTAQLQDGK
AKNQITLTLVDDDFDKLLRKADAKRRDWKRKQGPYFEQPLQWKVTEDCQVQLTCKATNTK
KETRFQWFFQRAEMPDGQYDLETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTG
DALDAIFTELGRIGALSATPLKIQGTEVGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDR
IRTGTTLDEIWLHILDPKDSDKGKYTLEIAAGKEVRQLSTDLSGQAFEDAMAEHQRLKAL
AIIEKNRAKVVRGLPNVATIMEDKTLCLTCVVSGDPTPEISWLKNDQPVTFLDRYRMEVR
GTEVTITIEKVNSEDSGRYGVFVKNKYGSETGQVTISVFKHGDEPKELKSM
Download sequence
Identical sequences ENSNLEP00000010799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]