SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010822 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010822
Domain Number 1 Region: 49-150
Classification Level Classification E-value
Superfamily Fibronectin type III 2.28e-28
Family Fibronectin type III 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010822
Domain Number - Region: 141-225
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00261
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010822   Gene: ENSNLEG00000008862   Transcript: ENSNLET00000011351
Sequence length 605
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:5039180:5061077:-1 gene:ENSNLEG00000008862 transcript:ENSNLET00000011351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWSQLPGCQDSQPCLCAPQSTGQGRAPCPAPMRMLLTILTVGSLACHAPEDPSDLLQH
VKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKGCQRITRKSCNLTETGNLT
ELYYARVTAVSAGGRTATKMTDRFSSLQHTTLKPPDVTCIPKVRSIQMIVHPTPTPIRAG
DGHQLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWS
KESAPYMCRVKTLPDRTWTYSFSGGFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLXXXRV
LTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQ
PDISILQPSNMPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQLPFYTPQAISKVQPPS
YAPQATVDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMSGGLSLQE
VTSLAMEESQEAKSLHQPLGICTNRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPM
SLPLQPPSCPCSPSDQGPSPWGLLESLVCPRDEAKSPGPETSDLEQPTELDSLFRGLALT
VQWES
Download sequence
Identical sequences ENSNLEP00000010822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]