SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010841 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010841
Domain Number 1 Region: 26-116
Classification Level Classification E-value
Superfamily Fibronectin type III 4.27e-20
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 2 Region: 109-218
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000304
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010841   Gene: ENSNLEG00000008884   Transcript: ENSNLET00000011370
Sequence length 521
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:5071402:5103432:-1 gene:ENSNLEG00000008884 transcript:ENSNLET00000011370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQ
SSPTHRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSRSPWVESEYLDYL
FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQ
PVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWAFLVLPSLLILLL
VIAAGGVIWKSLMGNPWFQRAKMPRALDFSGHAHPVATFQPSRPESVNDLFLCPQKELTR
GVRPTPRVRAPATQQAGWKKDLTGEEDEDEDEEDTEDGVRFQPYIQPPSFLGQEHQVPGH
SEAGGVDSGRPRASLVPSEGSSAWDSSDRSWASTVDSSWDRAGSSDYLAEKGPGQGDGHQ
ESLPPPEFSKDSGFLEEPSKDDLSSWATWGTLPPETNLVPGGPLVSLRTLTFCWESSPEE
EEEEEEARESETEDSDAGSWGAESTQRTEERGRTLGHYMAR
Download sequence
Identical sequences G1RC92
ENSNLEP00000010841 XP_004092262.1.23891 ENSNLEP00000010841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]