SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010852 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010852
Domain Number 1 Region: 460-556
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 2 Region: 229-337
Classification Level Classification E-value
Superfamily Cadherin-like 2e-17
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 141-236
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000003
Family Cadherin 0.0051
Further Details:      
 
Domain Number 4 Region: 335-468
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000343
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 560-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000799
Family Cadherin 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010852
Domain Number - Region: 28-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.000542
Family Cadherin 0.0072
Further Details:      
 
Domain Number - Region: 644-702
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0559
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010852   Gene: ENSNLEG00000008878   Transcript: ENSNLET00000011381
Sequence length 883
Comment pep:known_by_projection supercontig:Nleu1.0:GL397314.1:3705652:3777718:-1 gene:ENSNLEG00000008878 transcript:ENSNLET00000011381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEAIILLALVGSSRGGEALHLILLPATGNVAENSPPGTSVHKFSVKLSASLSPVIPGFP
QIINSNPLTDAFRVNCLSGTYFEIVTTGKEQLDFETGPNIFDLQIYVKDEVGVTDLQVLT
VQVADVNEPPQFQGNLAEGLHLYIVEGANPGFIYQVEAFDPEDTSQNIPLSYFLISPSKN
FRMSANGTLFSTTELDFEAGHRSFHLIVEVRDSGGLKASTELQVNIVNLNDEAPRFTSPT
RVYTIREELSPGTIVANITAEDPDNEGFPSHLLYSITTVSKYFMINQLTGTIQVAQRIDR
DAGELRQNPTISLEVLVKDRPYGGQENRIQITFLVEDINDNPATCQKFTFSIMVPERTAK
GTSLLDLNKFCFDDDSEAPNNRFNFTMPSGVGSGGRFLQDPAGSGKIVLIGDLDYENPSN
LAAGNKYTVIIQVQDVAPPYYKNNIYVYILTSPENEFPLIFDRPSYVFDVSERRPARTRV
GQVRATDKDLPQSSLVYSISTGGGSLQYPNVFWINPKTGELQLVTKVDYETTPIYILRIQ
ATNNEDTSSVTVTVNIVEENDEKPICTPNSYFLALPVDLKVGTNIQNFKLTCTDLDSSPR
SFRYSIGPGNVNNHFTFSPNAGSNVTRLLLTSRFDYAGGLDKIWDYKLLVYVTDDNLLSD
RKKAEALVETGTVTLNIKVIPHPTTIITTTPRPRVTYQVLRKNVYSPSAWYVPFVITLGS
ILLLGLLVYLVVLLAKAIHRHCPCKTGKNKEPLVASGWALLSLSSPETLQMNTVFDGEAI
DPVTGEIYEFNSKTGARKWKDPLTQMPKWKESSPQGAAPRRVTAGEGMGSLRSANQEEDE
PSGKAWAEDAGLGSRNEGGKSGTPKNRNPAFMNRASPKPHPGK
Download sequence
Identical sequences ENSNLEP00000010852 ENSNLEP00000010852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]