SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010913 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010913
Domain Number 1 Region: 157-195,229-266
Classification Level Classification E-value
Superfamily Immunoglobulin 8.8e-17
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000502
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 111-157
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000134
Family Ovomucoid domain III-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010913   Gene: ENSNLEG00000008935   Transcript: ENSNLET00000011445
Sequence length 282
Comment pep:known_by_projection supercontig:Nleu1.0:GL397316.1:5438266:5529968:-1 gene:ENSNLEG00000008935 transcript:ENSNLET00000011445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPSLRALLLGAAGLLPLLLPLSSSSSSDTCGPCEPAACPPLPPLGCLLGETRDACGCC
PMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVC
GSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLS
CEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSK
EDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Download sequence
Identical sequences ENSNLEP00000010913 ENSNLEP00000010913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]