SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010920 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010920
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-50
Family SPRY domain 0.00074
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000103
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 4 Region: 372-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000138
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010920
Domain Number - Region: 108-161
Classification Level Classification E-value
Superfamily RING/U-box 0.000636
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010920   Gene: ENSNLEG00000008909   Transcript: ENSNLET00000011452
Sequence length 667
Comment pep:known_by_projection supercontig:Nleu1.0:GL397281.1:7698072:7883749:-1 gene:ENSNLEG00000008909 transcript:ENSNLET00000011452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDANTMTSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFMVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCMTIITGLPIPDHL
DCTEQLP
Download sequence
Identical sequences G1RCH1
ENSNLEP00000010920 XP_003261052.1.23891 XP_003261053.1.23891 XP_003261054.1.23891 XP_003261055.1.23891 ENSNLEP00000010920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]