SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010925 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010925
Domain Number 1 Region: 1146-1411
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-51
Family YWTD domain 0.00000189
Further Details:      
 
Domain Number 2 Region: 416-678
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-47
Family YWTD domain 0.00000554
Further Details:      
 
Domain Number 3 Region: 1766-2011
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-47
Family YWTD domain 0.0000172
Further Details:      
 
Domain Number 4 Region: 1461-1718
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-43
Family YWTD domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 91-336
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-42
Family YWTD domain 0.0000548
Further Details:      
 
Domain Number 6 Region: 2901-3156
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-41
Family YWTD domain 0.0000206
Further Details:      
 
Domain Number 7 Region: 2075-2342
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-32
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 8 Region: 3777-4054
Classification Level Classification E-value
Superfamily YWTD domain 1.8e-30
Family YWTD domain 0.0000582
Further Details:      
 
Domain Number 9 Region: 2807-2893,3149-3210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 6-79,672-721
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 11 Region: 3683-3801,4046-4102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000251
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 12 Region: 1049-1138,1412-1456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000228
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 3645-3683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000511
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 763-808
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 15 Region: 3517-3553
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 16 Region: 806-845
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 17 Region: 728-767
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 18 Region: 2776-2817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 2645-2681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 20 Region: 3478-3515
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 3438-3473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 22 Region: 3238-3278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 23 Region: 851-889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 3559-3604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 25 Region: 3360-3396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 26 Region: 890-928
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00024
Further Details:      
 
Domain Number 27 Region: 2431-2472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 2566-2602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 29 Region: 2687-2723
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 3201-3236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 938-974
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 32 Region: 3395-3435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 33 Region: 3321-3357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 3280-3317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 35 Region: 2475-2512
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 36 Region: 2605-2647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 37 Region: 1720-1770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family EGF-type module 0.016
Further Details:      
 
Domain Number 38 Region: 2725-2765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 39 Region: 2525-2561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 2397-2433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 41 Region: 1020-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 42 Region: 984-1017
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000929
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 43 Region: 2030-2079
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000327
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 44 Region: 4279-4313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family EGF-type module 0.047
Further Details:      
 
Domain Number 45 Region: 3605-3637
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 46 Region: 4173-4208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000010925
Domain Number - Region: 4137-4171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000116
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 4100-4136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 369-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 4210-4242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0433
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 2353-2411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0884
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010925   Gene: ENSNLEG00000008924   Transcript: ENSNLET00000011457
Sequence length 4405
Comment pep:known_by_projection supercontig:Nleu1.0:GL397311.1:7822266:8881159:-1 gene:ENSNLEG00000008924 transcript:ENSNLET00000011457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLSNCQQLNCQYRCTMVRNSTRCYCEDGFEIKEDGRSCKDQDECAVYGTCSQTCRNTHG
SYICSCVEGYLMQPDNRSCKAKIEPTDRPPILLIANFETIEVFYLNGSKMATLSSVNGNE
IHTLDFIYNEDMICWIESRESSNQLKCIQITKAGGLTDEWTINILQSFHNVQQMAIDWLT
RNLYFVDHVSDRIFVCNYNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERC
DMDGMNRTRIIGSKTEQPAALALDLVNKLVYWVDLYLECVGVVDYQGKNRHSVIQGRQVR
HLYGITVFEDYLYATNSDNYNIIRINRFNGTDIHSLIKIENARGIRIYQKRTQPTVRSHA
CEVDPYGMPGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGI
VRGMDLNTKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETIL
KDDLDNVEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDP
LNGWMYWTDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDA
YYDHIEKVFLNGTHRKIVYSGRELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITSEVTLL
RHERPPLFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDANGTTCT
FNPGEALPRICKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQ
NNRCIPKRWLCDGANDCGSNEDESNQTCTARTCQVDQFSCGNGRCIPRAWLCDREDDCGD
QADEMASCEFPTCEPLTQFVCKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCFDNQFRCS
SGRCIPGHWACDGDNDCGDFSDEAQINCTKEEIRSPAGCNGNEFQCHPDGNCVPDLWRCD
GEKDCEDGSDEKGCNGTIRLCDHKTKFSCWSTGRCINKAWVCDGDIDCEDQSDEDDCDSF
LCGPPKYPCANDTSVCLQPEKLCNGKKDCPDGSDEGDLCDECSLNNGGCSYHCSVVPERG
IVCSCPEGLQLNKDNKTCEIVDYCSNHLKCSQVCEQHKRTVKCSCYEGWKLDVDGESCTS
VDPFEAFIIFSIRHEIRRIDLHRRDYSLLVPGLRNTIALDFHFSQSLLYWTDVVEDRIYR
GKLSESGGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIA
GAMEHPRAIALDPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDH
FEKRIVWTDARSDAIYSALYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSK
ANKWTGQNVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINHNRSAAC
ACPHLMKLSSDKKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFD
ASEERLYWTDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQ
INVARLDGSLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKE
PVGLSIDYVENKLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWAD
QNLAQLGTCSKRDGRNPTILRNKTSGVVHMKVYDKEAQQGSNSCQLNNGGCSQLCLPTSE
TTRSCMCTVGYYLQKNRMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVG
IDFHAENDTIYWTDMGFNKISRAKRDQTWKEDIVTNGLGRVEGIAIDWIAGNIYWTDHGF
NLIEVARLNGSFRYVIISQGLDQPRSIAVHPEKGLLFWTEWGQMPCIGKARLDGSERAVL
VSMGIAWPNGISIDYEENKLYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVAVFGA
YIYWSDRAHANGSVRRGHKNDATETITMRTGLGVNLKEVKIFNRVREKGTNVCARDNGGC
KQLCLYRGNSRRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRP
YENPHYFKNVIALAFDYNQRRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGL
AYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFDREAVITMSEDDHPHVLALDECQNLMFW
TNWNEQHPSIMRSTLTGKNAQVVVSTDILTPNGLTIDYRAEKLYFSDGSLGTIERCEYDG
SQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGII
AVANDTNSCELSPCALLNGGCHDLCLLTPNGRVNCSCRGDRILLEDNRCVTKNSSCNIYL
EFECGNGECIDYQLTCDGIPHCKDKSDEKLLYCENRSCRRGFKPCYNRRCIPHGKLCDGE
NDCGDNSDELDCKVSTCATVEFRCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFY
KLGVKTTGFIRCNSTSLCVLPTWICDGSNDCGDYSDELKCPVQNKHKCEENYFSCPSGRC
ILNTWICDGQKDCEDGLDEFHCDSSCSWNQFACSAQKCISKHWICDGEDDCGDGLDESDS
ICGAVTCAADMFSCQGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENAFMCHN
KVCIPKQFVCDHDDDCGDGSDESPQCGYRQCGPEEFSCADGRCLLNTQWQCDGDFDCPDH
SDEAPLNPKCKSAEQSCNSSFFMCKNGRCIPSGGLCDNKDDCGDGSDERNCHINECLSKK
VSGCSQDCQDLPVSYKCKCWPGFQLKDDGKTCVDIDECSSDFPCSQQCINTYGTYRCLCT
DGYEIQPDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYRE
EFIYWIDSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVS
KLNGLYPTMLVSKRLKFPRDLSLDPRAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKIS
RPMALTIDYVNRRLYWADENHIEFSNMDGSHRYKVPNQDIPGVIALTLFEDYIYWTDGKT
KSLSRAHKTSGADRLSLINSWHAITDIQVYHSYRQPDVSKHLCMINNGGCSHLCLLAPGK
THTCACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPE
FKCQPGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNL
RCNGQDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKK
TCGPHEFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWC
DGDFDCADGSDERNCETSCSKDQFQCSNGQCIPAKWKCDGHEDCKYGEDEKSCDPASPTC
SSSEYICASGGCISASLKCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDG
IHDCVDGSDEENCDRGGNICRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCVKFL
CPSTRPHRCRNNRICLQSEKMCNGIDDCGDNSDEDHCGGKPTYKARPCKKDEFTCSNKKC
IPMDLQCDRLDDCGDGSDEQGCRIAPTEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQ
RNMKNRQCEDLNECLVFGTCSHQCINVEGSYKCVCDQNFQERNNTCIAKGSEDQVLYIAN
DTDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYRDMIIWSTQFNPGGIFYKTIHGRE
KRQANSGLICPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNG
PNCTRLLTNMAGEPYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNLQRPTG
LAVDYFSERIYWADFELSIIGSVLYDGSNSVVSVSSKQGLLHPHRIDIFEDYIYGAGPKN
GVFRVQKFGHGSVEYLALNIDKTKGVLISHHYKQLDLPNPCLDLACEFLCLLNPSGATCV
CPEGKYLINGTCNDDSLLDDSCKLTCENGGRCILNEKGDLRCHCWPSYSGERCEVNHCSN
YCQNGGTCIPSVLGRPTCSCALGFTGPNCGKTVCEDFCQNGGTCIVTAGNQPYCHCQLEY
TGDRCQYYVCHHYCVNSESCTIGDDGSVECVCPTRYEGPKCEVDKCVRCHGGHCIINKDS
EDIFCNCTNGKIASSCQLCDGYCYNGGTCQLDPETNVPVCLCSTNWSGTQCERPAPKSSK
SDHISTRSIAIIVPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSY
NMYEVDHDHSDGGLLDPGFMIDPTK
Download sequence
Identical sequences ENSNLEP00000010925 ENSNLEP00000010925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]