SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010942 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010942
Domain Number 1 Region: 25-128
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000424
Family Dystroglycan, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010942   Gene: ENSNLEG00000008950   Transcript: ENSNLET00000011474
Sequence length 387
Comment pep:known_by_projection supercontig:Nleu1.0:GL397531.1:671289:681335:1 gene:ENSNLEG00000008950 transcript:ENSNLET00000011474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLFWTPLLLVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHI
TYHAHLQGHPDLPRWLRYTQRSPQHPGFLYGSATPEDRGRQVIEVTAYNRDSFDTTQQRL
VLEIGDPEGPLLPYQAEFLVRSHDVEEVLPSTPASRFLSALGGLWEPGELQLVNITSALD
RGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSYARCAQGQPPLLSCYDTLAPHF
RVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLV
ALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAASREVPRPLSTL
PMFNVRTGERLPPRVDSAQVPLILDQH
Download sequence
Identical sequences G1RCJ3
ENSNLEP00000010942 ENSNLEP00000010942 XP_003281290.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]