SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010973 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010973
Domain Number 1 Region: 44-143
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.35e-47
Family ets domain 0.00000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010973   Gene: ENSNLEG00000009001   Transcript: ENSNLET00000011509
Sequence length 238
Comment pep:known_by_projection supercontig:Nleu1.0:GL397345.1:878220:882222:-1 gene:ENSNLEG00000009001 transcript:ENSNLET00000011509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQSGASQPLLINMYLPDPVGDGLFKEGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDQNIMSKVHGK
RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH
Download sequence
Identical sequences ENSNLEP00000010973 ENSNLEP00000010973 XP_003272429.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]