SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010990 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010990
Domain Number 1 Region: 19-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family V set domains (antibody variable domain-like) 0.0088
Further Details:      
 
Domain Number 2 Region: 147-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000207
Family C2 set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010990   Gene: ENSNLEG00000009009   Transcript: ENSNLET00000011527
Sequence length 290
Comment pep:known_by_projection supercontig:Nleu1.0:GL397359.1:6325903:6344173:1 gene:ENSNLEG00000009009 transcript:ENSNLET00000011527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRSDPEENHTAELVIPELPLAHPPNERTH
LVILGAILVFLGVALTFIFCLRKGRMMDVKKCGIRDTNSKKQSDTQLEET
Download sequence
Identical sequences G1RCP1
XP_003273874.1.23891 ENSNLEP00000010990 ENSNLEP00000010990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]