SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000010993 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000010993
Domain Number 1 Region: 146-254
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-25
Family Cadherin 0.00032
Further Details:      
 
Domain Number 2 Region: 366-486
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-25
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 255-371
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-23
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 475-584
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 69-153
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000034
Family Cadherin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000010993   Gene: ENSNLEG00000009005   Transcript: ENSNLET00000011530
Sequence length 785
Comment pep:known_by_projection supercontig:Nleu1.0:GL397295.1:11303890:11428977:1 gene:ENSNLEG00000009005 transcript:ENSNLET00000011530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGKVEFCHFLQLIPLFLCFSGMSQAELSRSRSKPYFQSGKSRTKRSWVWNQFFVLEEY
MGSDPLYVGKLHSDVDKGDGSIKYILSGEGASSIFIIDENTGDIHATKRLDREEQAYYTL
RAQALDRLTNKPVEPESEFVIKIQDINDNEPKFLDGPYTAGVPEMSPVGTSVVQVTATDA
DDPTYGNSARVVYSILQGQPYFSVEPKTGVIKTALPNMDREAKDQYLLVIQAKDMVGQNG
GLSGTTSVTVTLTDVNDNPPRFPRRSYQYNVPESLPVASVVARIKAADADIGANAEMEYK
IVDGDGLGIFKISVDKETQEGIITIQKELDFEAKTSYTLRIEAANKDADPRFLSLGPFSD
TTTVKIIVEDVDEPPVFSSPLYPMEVSEATQVGNIIGTVAAHDPDSSNSPVRYSIDRNTD
LERYFNIDANSGVITTAKSLDRETNAIHNITVLAMESQNPSQVGRGYVAITILDINDNAP
EFAMDYETTVCENAQPGQVIQKISAVDKDEPSSGHQFYFSLTTDATNNHNFSLKDNKDNT
ASILTRRNGFRRQEQSVYYLPIFIVDSGSPSLSSTNTLTIRVCDCDADGVAQTCNAEAYV
LPAGLSTGALIAILACVLTLLVLILLIITMRRRKKEPLIFDEERDIRENIVRYDDEGGGE
EDTEAFDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKSIPDNVIFREFIWERLKEADV
DPGAPPYDSLQTYAFEGNGSVAESLSSLDSISSNSDQNYDYLSDWGPRFKRLADMYGTGQ
ESLYS
Download sequence
Identical sequences G1RCP4
ENSNLEP00000010993 ENSNLEP00000010993 XP_003264370.1.23891 XP_003264371.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]