SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011009 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011009
Domain Number 1 Region: 95-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000117
Family C1 set domains (antibody constant domain-like) 0.096
Further Details:      
 
Domain Number 2 Region: 21-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000275
Family I set domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011009   Gene: ENSNLEG00000009028   Transcript: ENSNLET00000011548
Sequence length 273
Comment pep:known_by_projection supercontig:Nleu1.0:GL397359.1:6389963:6455535:1 gene:ENSNLEG00000009028 transcript:ENSNLET00000011548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ
KVENDTSPHRERATLLEEQLPLGKALFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK
ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL
RLKLHPGRNFSCVFWNTHVKEFTSASIDLQSQMEPRTRPTWLLHIFIPSCIIAFIFIATV
IALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
Download sequence
Identical sequences G1RCR0
XP_003273875.1.23891 ENSNLEP00000011009 ENSNLEP00000011009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]