SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011025 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011025
Domain Number 1 Region: 670-950
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-84
Family Protein kinases, catalytic subunit 0.000000000801
Further Details:      
 
Domain Number 2 Region: 60-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-71
Family Ephrin receptor ligand binding domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 357-560
Classification Level Classification E-value
Superfamily Fibronectin type III 2.92e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 966-1033
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-21
Family SAM (sterile alpha motif) domain 0.00058
Further Details:      
 
Domain Number 5 Region: 285-349,395-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000718
Family Growth factor receptor domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011025   Gene: ENSNLEG00000008987   Transcript: ENSNLET00000011568
Sequence length 1038
Comment pep:known_by_projection supercontig:Nleu1.0:GL397316.1:12784154:13143178:-1 gene:ENSNLEG00000008987 transcript:ENSNLET00000011568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSGPRGAGRRRPPSGGGDTPVTPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVSVAASSDQSQIPIIAVSVTVGVILLAVVIGFLLSGSCC
ECGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDP
NQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRR
DFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVG
MLRGISSGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGK
IPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPS
PMDCPAALYQLMLDCWQKDRNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEH
SPLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKI
MNSLQEMKVPLVNGMVPL
Download sequence
Identical sequences G1RCS6
ENSNLEP00000011025 XP_012354777.1.23891 ENSNLEP00000011025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]