SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011108 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011108
Domain Number 1 Region: 138-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000124
Family I set domains 0.082
Further Details:      
 
Domain Number 2 Region: 26-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000032
Family V set domains (antibody variable domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011108   Gene: ENSNLEG00000009116   Transcript: ENSNLET00000011657
Sequence length 335
Comment pep:known_by_projection supercontig:Nleu1.0:GL397295.1:15287201:15384550:-1 gene:ENSNLEG00000009116 transcript:ENSNLET00000011657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYPTLLLALLHVYRALCEEVLWHTSVPFAKNMSLECVYPSMGILTQVEWFKIGTEKDSI
AIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQK
VIQVVQSDSFEAAVPSNSHIVSEPGKNITLACQPQMTWPVQEVRWEKIQPHQIDLLTYCN
LVHGRNFTSKFPRQIVSNCSHGRWSVIVIPNVTASDSGLYRCHLQASAGENETVMRLTIA
EGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNYR
SPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV
Download sequence
Identical sequences G1RD09
ENSNLEP00000011108 ENSNLEP00000024136 XP_003264377.1.23891 XP_012361721.1.23891 ENSNLEP00000011108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]