SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011110 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011110
Domain Number 1 Region: 52-129
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.31e-26
Family Ribosomal protein S18 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011110   Gene: ENSNLEG00000009119   Transcript: ENSNLET00000011659
Sequence length 144
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:15556754:15562497:1 gene:ENSNLEG00000009119 transcript:ENSNLET00000011659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMVAVCGGLGRKKFTHLVTAAISLTHPGTHTVLWRRGCSQYKQESSNEDLPIPMENPY
KEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMG
FMPVTYKDPAYLKDPKVCNIRYRE
Download sequence
Identical sequences A0A2I3GX69
ENSNLEP00000011110 ENSNLEP00000011110 XP_003265893.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]