SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011122 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011122
Domain Number 1 Region: 52-106
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000418
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011122   Gene: ENSNLEG00000009143   Transcript: ENSNLET00000011672
Sequence length 185
Comment pep:known_by_projection supercontig:Nleu1.0:GL397473.1:908178:910381:1 gene:ENSNLEG00000009143 transcript:ENSNLET00000011672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRREPQGALGPPPPSPATPWLYIATQQSPCRMLQPEGPQASEEGGPRRKDCIICCSAY
DLSGHLPRHLYCGHTFCQACARRLDARAPEQCWIPCPQCRQGTPTPRGGVALLDLDLAAF
LAVKAEWEPARLEPLPLTSLKGSAITQQPAGLCPALGPQPHFPWPRYCCWGCGSLCCPPP
GSPEV
Download sequence
Identical sequences ENSNLEP00000011122 XP_004092974.2.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]