SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011188 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011188
Domain Number 1 Region: 115-177
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.000048
Further Details:      
 
Domain Number 2 Region: 14-109
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000131
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011188
Domain Number - Region: 200-253
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.034
Family C-terminal domain of PLC-beta 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011188   Gene: ENSNLEG00000009190   Transcript: ENSNLET00000011741
Sequence length 349
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:6844635:6893675:-1 gene:ENSNLEG00000009190 transcript:ENSNLET00000011741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWT
SRGSSASMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHP
MCKEHEDEKINIYCLTCEVPTCSMCKVFGVHKACEVAPLQSVFQGQKTELNNCISMLVAG
NDRVQTIITQLEDSCRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEEKLS
FIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLVSRTRRVSIVEASKGCQLGKTEQ
GFENMDYFTLNLEHIADALRAIDFGTETNTLGDGNEPEQEGEDSTEGEE
Download sequence
Identical sequences ENSNLEP00000011188 ENSNLEP00000011188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]