SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011216 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011216
Domain Number 1 Region: 122-218
Classification Level Classification E-value
Superfamily Fibronectin type III 3.39e-22
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 214-316
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000023
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011216   Gene: ENSNLEG00000009199   Transcript: ENSNLET00000011769
Sequence length 629
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:36535:124958:1 gene:ENSNLEG00000009199 transcript:ENSNLET00000011769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERSQMTRINKTTARLWYKNFLEPHASMHCTAECPKHFQETLICGKDIS
SGYPPDVPDEVTCIIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSASIISRAETINATVPKTII
YWDSQTTIEKISCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSPFFHKTPETVPQVTSKSSQHDTWNSGLTVASISTGHLTSDNREDIGLLLGM
IVFAVMLSILSLIGIFNRSLRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNPCEQVLYVDPMITEIKEIFIPECKPTDCKKENTGPLETRDGLENSLFDNTTVVYIPDL
NTGYKPQISNFLPGGNRLSNSNEITSLTLKPPADSLDSGNNPRLQKHPNFAFSVSSVNSL
SNPLFLGELSLILNQGECSSPAIQNSVGEETSMLLGNDSPSETIPEQTLLPDEFVSCLRI
VNEELPSINSYFPQNILESHFNRISLLEK
Download sequence
Identical sequences A0A2I3HK34
ENSNLEP00000011216 ENSNLEP00000011216 XP_003260210.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]