SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011298 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011298
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.64e-121
Family Transglutaminase core 0.0000000000118
Further Details:      
 
Domain Number 2 Region: 3-139
Classification Level Classification E-value
Superfamily E set domains 3.5e-42
Family Transglutaminase N-terminal domain 0.000000255
Further Details:      
 
Domain Number 3 Region: 482-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.66e-31
Family Transglutaminase, two C-terminal domains 0.000000681
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.13e-26
Family Transglutaminase, two C-terminal domains 0.00000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011298   Gene: ENSNLEG00000009248   Transcript: ENSNLET00000011855
Sequence length 693
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:610236:655419:-1 gene:ENSNLEG00000009248 transcript:ENSNLET00000011855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGSDERLEFIVST
GPYPSESAMTKAVFPLSNGSSGGWSAVLQASNGNTLTITISSPASAPIGRYTMALQIFSQ
GGVSSVKLGTFILLFNPWLNADSVFMGNHAEREEYVQEDAGIIYVGSTNRIGMIGWNFGQ
FEEDILSICLSILDRSLNFRRDAATDVARRNDPKYVGRVLSAMINSNDDNGVLAGNWSGT
YTGGRDPRNWNGSVEILKNWKKSGFSPVRYGQCWVFAGTLNTALRSLGIPSRVITNFNSA
HDTDRNLSVDVYYDRMGNPLDKGSDSVWNFHVWNEGWFVRSDLGPSYGGWQVLDATPQER
SQGVFQCGPASVIGVREGDVQLNFDMPFVFAEVNADRITWLYDDTTGIQRKNSVNSHTIG
RYISTKAVGSNARMDVTDKYKYPEGSDQERKVFQKALGKLRPNASFGATSSMGLEREEQE
PSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIVYNGTLVHEVWKDSAT
MSLDPEEEAEHPVKISYAQYEKYLKSDNMIRITAVCKVPDESEVVVERDVILDNPTLTLE
VLDEARVQKPVNVQMLFSNPLDEPVRDCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFHAIKAMLSIDVAK
Download sequence
Identical sequences G1RDJ9
ENSNLEP00000011298 ENSNLEP00000011298 XP_003273479.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]