SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011347 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011347
Domain Number 1 Region: 248-337
Classification Level Classification E-value
Superfamily Immunoglobulin 4.74e-18
Family C1 set domains (antibody constant domain-like) 0.012
Further Details:      
 
Domain Number 2 Region: 32-149
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-17
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 
Domain Number 3 Region: 112-234
Classification Level Classification E-value
Superfamily Immunoglobulin 3.25e-16
Family C1 set domains (antibody constant domain-like) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011347   Gene: ENSNLEG00000009322   Transcript: ENSNLET00000011906
Sequence length 397
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:1293845:1350054:1 gene:ENSNLEG00000009322 transcript:ENSNLET00000011906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPASWPHPPGPFLLLTLLLGLTGVAGEEELQVIQPEKSVSVVAGESATLHCHMTSLIP
VGPIQWFRGAGPGRELIYNQKEGHFPRVTAVSDLTKRNNMDFSIRISNITPADAGTYYCV
KFRKGSTVDVEFKSGAGTELSVLAKPSTPVVSGPAARATPEHTVSFTCESHGFSPRDITL
KWFKNGNQLSDFQTNVDPTGRSVAYSIRSTARVVLDPWDVRSQVMCEVGHVTLQGDPLRG
TANLSEAIRVPPTLEVFQQPMRAENQTNVTCQVRKFYPQRLQLTWLENGNVSRTETASTL
TENKDGTYNWMSWLLVNTCAHRDDVKLTCQVEHDGQPAISKSHDLKVSAHQKEQCSDTPP
GPALAPTAPLLVAFLLGPKVLLVVGVSVIYVYWKQKA
Download sequence
Identical sequences ENSNLEP00000011347 ENSNLEP00000011347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]