SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011356 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011356
Domain Number 1 Region: 112-234
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-16
Family C1 set domains (antibody constant domain-like) 0.019
Further Details:      
 
Domain Number 2 Region: 33-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000435
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011356   Gene: ENSNLEG00000009322   Transcript: ENSNLET00000011915
Sequence length 276
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:1293845:1322468:1 gene:ENSNLEG00000009322 transcript:ENSNLET00000011915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGETATLHCTVTSLLP
VGPVMWFRGAGPGRELIYNQKEGHFPRVTAVSDLTKRNNMDFSIRISNITPADAGTYYCV
KFRKGSPENMEFKSGPGTEMALRAKPSAPVVSGPAVRTTPEHTVSFTCESHGFSPRDITL
KWFKNGNQLSDFQTNVDPTGRSVAYSIRSTARVVLDPWDVRSQVMCEVGHVTLQGDPLRG
TANLSEAIRGPASSLTALLLIAVLLGPIYIPWKQKT
Download sequence
Identical sequences G1RDQ7
ENSNLEP00000011356 XP_003273486.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]