SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011359 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011359
Domain Number 1 Region: 32-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000543
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011359   Gene: ENSNLEG00000009332   Transcript: ENSNLET00000011918
Sequence length 197
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:1372302:1404821:1 gene:ENSNLEG00000009332 transcript:ENSNLET00000011918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILASPLHPPLPSLLLYLLLELAGATHVFHVQQTEMSQTVSTGESIILSCSVPDTLPNG
PVLWFKGTGPNRKLIYNFKQGHFPRVKEIGDTTKPGNTDFSIHISEISLADAGIYYCVKF
IKGRAIKEYQSGRGTQVFVTEQNPGPPQNRPIGRAGSRAHHDARPCLSALPERNNTDYFI
HPCCCLWLLGLTGLLSK
Download sequence
Identical sequences G1RDR0
XP_003273653.2.23891 ENSNLEP00000011359 ENSNLEP00000011359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]