SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011366 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011366
Domain Number 1 Region: 160-265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000115
Family V set domains (antibody variable domain-like) 0.018
Further Details:      
 
Domain Number 2 Region: 41-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000511
Family V set domains (antibody variable domain-like) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011366   Gene: ENSNLEG00000009335   Transcript: ENSNLET00000011925
Sequence length 342
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:1449917:1466609:1 gene:ENSNLEG00000009335 transcript:ENSNLET00000011925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTMSAPTCLARLLPCFLLLALVLVPSDASGQSSRNDWQVLQPEGPMLVAEGETLLLRC
MAVGSCTDGMIKWVKVRTQDQQEIYNFKHGSFPGVMPMIQRTSEPLNCDYSIYIHNVTRE
HTGTYHCVRFDDLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNC
TVLGDGPPGPIRWFQGAGLSREAIYNFGGNSRPKATAVRTSNSDFSILLQNVSSEDAGTY
YCVKFQRKPNRQYLSGQGTRLKVKAKSTSSQEAEFTSEHATEMSATGLLVVFAPVVLGLK
AITLAALLLALATSRRSPGQEDVKTTGPAGAMNTLAWSKGQE
Download sequence
Identical sequences G1RDR7
ENSNLEP00000011366 ENSNLEP00000011366 XP_003273492.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]