SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011387 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011387
Domain Number 1 Region: 160-307
Classification Level Classification E-value
Superfamily C-type lectin-like 2.92e-44
Family C-type lectin domain 0.00000217
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011387
Domain Number - Region: 95-132
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.068
Family XRCC4, C-terminal oligomerization domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011387   Gene: ENSNLEG00000009355   Transcript: ENSNLET00000011946
Sequence length 316
Comment pep:known_by_projection supercontig:Nleu1.0:GL397365.1:2133735:2138932:-1 gene:ENSNLEG00000009355 transcript:ENSNLET00000011946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTYENFQYLENEEKVQGFKNGPPPPQSLLQRLHSGPCLLLLSLGLGLLLLVIICVVGF
QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTFQGSSLEETIASLKAEVERLKQERQAGVS
ELQEHTKQKAHLGHCPHCPSVCVPVHSEMLLRVQRLVQDLNKLTCQVATLNNNASTEGTC
CPVNWVEHRDSCYWFSRSGMPWAEAEKYCQLKDAHLVVINSREEQNFVQEHLGSAYTWMG
LSDSEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQKPY
HWVCEAGLGQTSQESH
Download sequence
Identical sequences G1RDT8
ENSNLEP00000011387 XP_003274651.1.23891 ENSNLEP00000011387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]