SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011392 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011392
Domain Number 1 Region: 345-563
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.55e-18
Family Laminin G-like module 0.068
Further Details:      
 
Domain Number 2 Region: 152-258
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.0044
Further Details:      
 
Domain Number 3 Region: 40-164
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000101
Family Cadherin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011392   Gene: ENSNLEG00000009357   Transcript: ENSNLET00000011951
Sequence length 983
Comment pep:known_by_projection supercontig:Nleu1.0:GL397361.1:3210863:3304656:-1 gene:ENSNLEG00000009357 transcript:ENSNLET00000011951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLI
ALDKDAPLRFAESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCEL
QKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYD
SILRVEAVDADCSPQFSQICSYEIITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAY
DCGKKRATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASVQ
ATVELETSHIGKGCDRDTYSEKSLHRLCGAAVGTAELLPSPSGSLNWTVGLPTDNGHDSD
QVFEFNGTQAVRIPDGIVSVSPKEPHGLGIWMKFFYFSFGSLVGNLPIETAFADMNRHHY
SLYVHGCRLIFLLRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTS
HEPFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGN
LAGLTLRSGKLADKKVIDCLYTCKEGLDLQVPEDSGRGVQIQAHPSQLVLTLEGEDLGEL
DKAMQHISYLNSRQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQPEEPKISLS
GVHHFARAASEFESSEGVFLFPELRIISTITREVEPEGDGAEDPTVQESLVSEEIVHDLD
TCEVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYR
NWHARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRS
FVDLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHQRTMRDQDAGKE
NEMDWDDSALTITVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEG
EQGDPQNATRQQQLEWDDSTLSY
Download sequence
Identical sequences ENSNLEP00000011392 ENSNLEP00000011392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]