SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011396 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011396
Domain Number 1 Region: 30-96
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.34e-18
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 4-37
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000415
Family eIF5a N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011396   Gene: ENSNLEG00000009358   Transcript: ENSNLET00000011955
Sequence length 98
Comment pep:novel supercontig:Nleu1.0:GL397365.1:2354807:2356831:1 gene:ENSNLEG00000009358 transcript:ENSNLET00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLQDSGEVREDLRLP
EGDLGKEIEQYDCGEEILITVLSAMTEEAAVAIKAMAK
Download sequence
Identical sequences ENSNLEP00000011396 ENSNLEP00000011396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]