SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011405 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011405
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily SIS domain 2.13e-85
Family Phosphoglucose isomerase, PGI 0.00000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011405   Gene: ENSNLEG00000009369   Transcript: ENSNLET00000011965
Sequence length 205
Comment pep:novel contig::ADFV01141923.1:710:7641:1 gene:ENSNLEG00000009369 transcript:ENSNLET00000011965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQ
HPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRP
TNSIVFTKLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSA
QVTSHDASTNGLINFIKQQREARVQ
Download sequence
Identical sequences ENSNLEP00000011405 ENSNLEP00000011405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]