SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011444 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011444
Domain Number 1 Region: 37-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-16
Family Growth factor receptor domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000011444
Domain Number - Region: 138-190
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000929
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011444   Gene: ENSNLEG00000009406   Transcript: ENSNLET00000012005
Sequence length 213
Comment pep:known_by_projection supercontig:Nleu1.0:GL397356.1:1956644:2120488:1 gene:ENSNLEG00000009406 transcript:ENSNLET00000012005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLCLLLLVAYAVDMLALNRRKKQVGTGLGGNCTGCIICSEENGCSTCQQRLFLFIRR
EGIRQYGKCLHDCPTGYFGIRGQEVNRCKKCGATCESCFSQDFCIRCKRRFYLYKGKCLP
TCPPGTLAHQNTRECQGECELGPWGGWSPCTHNGKTCGSAWGLETRVREAGRAGHEATAT
CQVLSESRKCPIQRPCPGESNPGLRRRKDRRPK
Download sequence
Identical sequences ENSNLEP00000011444 ENSNLEP00000011444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]