SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011446 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011446
Domain Number 1 Region: 194-332
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-28
Family Netrin-like domain (NTR/C345C module) 0.044
Further Details:      
 
Domain Number 2 Region: 66-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000114
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000031
Family EGF-type module 0.028
Further Details:      
 
Domain Number 4 Region: 129-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011446   Gene: ENSNLEG00000009407   Transcript: ENSNLET00000012007
Sequence length 335
Comment pep:known_by_projection supercontig:Nleu1.0:GL397322.1:2392579:2394247:1 gene:ENSNLEG00000009407 transcript:ENSNLET00000012007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRATARES
HACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRAL
SDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTP
IPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGAHGEARGAWTRFPV
AVLAVFRSGEERARRGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPG
LIAARGSLVLPWRDAWTRRLRRLQRRERRGRCNAA
Download sequence
Identical sequences ENSNLEP00000011446 ENSNLEP00000011446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]