SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000011515 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000011515
Domain Number 1 Region: 166-257
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-19
Family I set domains 0.0078
Further Details:      
 
Domain Number 2 Region: 76-156
Classification Level Classification E-value
Superfamily Immunoglobulin 4.96e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 17-86
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000279
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000011515   Gene: ENSNLEG00000009467   Transcript: ENSNLET00000012080
Sequence length 299
Comment pep:known_by_projection supercontig:Nleu1.0:GL397278.1:4358333:4926598:-1 gene:ENSNLEG00000009467 transcript:ENSNLET00000012080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VICRCYLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGP
YTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTINEGTNVTLTCLATGKPEPSISWRHI
TPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTV
TPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNY
TCVAANKLGTTNASLPLSPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ
Download sequence
Identical sequences ENSNLEP00000011515 ENSNLEP00000011515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]